Research Peptide Vials
CJC-1295
As a GHRH mimetic, CJC-1295 is frequently paired with Ipamorelin to leverage its enhanced specificity. Unlike other secretagogues, it increases GH/IGF-1 without raising prolactin levels. Its primary physiological benefits include accelerating protein synthesis to promote muscle growth and fat loss, as well as enhancing cellular repair and regeneration. Furthermore, it is known to facilitate deep slow-wave sleep, which is critical for memory retention and overall rejuvenation. Additional benefits include improved wound healing time, strengthened immune function, increased bone density, and the repair of skin and internal organs.
Product Name: | CJC1295 |
Synonyms: | CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 CJC-1295;CJC-1295 Acetate;CJC1295 with out DAC;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;CJC-1295(2MG) |
CAS: | 863288-34-0 |
MF: | C152H252N44O42 |
MW: | 3367.89688 |
EINECS: | 206-141-6 |
Product Categories: | Research Peptide |
CJC-1295 is a synthetic analog of Growth Hormone Releasing Hormone (GHRH), originally developed by the Canadian biotechnology firm ConjuChem. Composed of a 30-amino acid chain, this peptide has been scientifically proven to significantly elevate Growth Hormone (GH) and IGF-1 levels without negatively impacting the body’s natural pulsatile GH secretion.